BNP32 antibody
-
- Target See all BNP32 (BNP 32) Antibodies
- BNP32 (BNP 32) (Brain Natriuretic Peptide 32 (BNP 32))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BNP32 antibody is un-conjugated
-
Application
- ELISA, Immunohistochemistry (IHC), Dot Blot (DB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Brand
- IHC-plus™
- Purification
- Protein G purified
- Immunogen
-
Synthetic peptide (Human BNP: NH2-CSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) conjugated with KLH
Type of Immunogen: Synthetic peptide - KLH conjugated - Isotype
- IgG
-
-
- Application Notes
- Approved: DB, ELISA (1:40000), IHC, IHC-P (10 μg/mL)
- Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Reconstitute at 1 mg/mL in PBS
- Concentration
- Lot specific
- Buffer
- Lyophilized from PBS. No preservative added
- Preservative
- Without preservative
-
- Target
- BNP32 (BNP 32) (Brain Natriuretic Peptide 32 (BNP 32))
- Abstract
- BNP 32 Products
- Synonyms
- BNP antibody, natriuretic peptide B antibody, NPPB antibody
-