PRO-ANP antibody (AA 1-30)

Catalog No. ABIN109956

Product Details anti-PRO-ANP Antibody

Target: PRO-ANP (Pro-Atrial Natriuretic Peptide (PRO-ANP))

Binding Specificity: AA 1-30

Reactivity: Human

Host: Sheep

Clonality: Polyclonal

Conjugate: This PRO-ANP antibody is un-conjugated

Application: ELISA, Radioimmunoassay (RIA)

Specificity: Synthetic human pro-ANP (aa 1-30) There were no cross reactivities obtained with human pro-ANP (aa 31-67, 67-98) and human ANP (aa 1-28)

Immunogen: Synthetic human pro-ANP (aa 1-30) poly Lysin conjugated (npmynavsnadlmdfknlldhleekmpled)

Application Details

Application Notes: RIA (1/5000) ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details for PRO-ANP

Target: PRO-ANP (Pro-Atrial Natriuretic Peptide (PRO-ANP))

Alternative Name: Pro-Atrial Natriuretic Peptide (PRO-ANP Products)

Synonyms: anf antibody, hm:zeh1304 antibody, zeh1304 antibody, natriuretic peptide A antibody, natriuretic peptide A L homeolog antibody, nppa antibody, nppa.L antibody

Background: Serum

Gene ID: 4878