Thymosin beta-15 (AA 1-45) antibody
-
- Target
- Thymosin beta-15
- Binding Specificity
- AA 1-45
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- ELISA
- Specificity
- Human Thymosin 6153815 (aa 1-45)
- Immunogen
- Synthetic human Thymosin 6153815 (aa 1-45) KLH conjugated (MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS)
-
- Application Notes
- ELISA (1/80.000) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Resuspend in aqua bidest.
- Storage
- 4 °C
-
- Target
- Thymosin beta-15
- Alternative Name
- Thymosin beta15
- Background
- Serum
-