PLAC9 antibody (AA 23-97)
-
- Target See all PLAC9 Antibodies
- PLAC9 (Placenta-Specific 9 (PLAC9))
-
Binding Specificity
- AA 23-97
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLAC9 antibody is un-conjugated
-
Application
- Western Blotting (WB), ELISA, Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Sequence
- MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-AEPFSPPR GDSAQSTACD RHMAVQRRLD VMEEMVEKTV DHLGTEVKGL LGLLEELAWN LPPGPFSPAP DLLGDGF
- Specificity
- It has been selected for its ability to recognize PLAC9 in immunohistochemical staining and Western blotting.
- Purification
- Affinity Chromatography
- Immunogen
-
Recombinant PLAC9 expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against PLAC9. - Isotype
- IgG
- Top Product
- Discover our top product PLAC9 Primary Antibody
-
-
- Application Notes
-
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user. - Comment
-
Content: The quality control contains recombinant PLAC9 (Ala23~Phe97) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % . - Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.
- Preservative
- Sodium azide
- Precaution of Use
- WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
- Handling Advice
- Avoid repeated freeze/thaw cycles
- Storage
- 4 °C
- Storage Comment
- Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
- Expiry Date
- 12 months
-
- Target
- PLAC9 (Placenta-Specific 9 (PLAC9))
- Alternative Name
- Placenta Specific Protein 9 (PLAC9) (PLAC9 Products)
-