TUBG2 antibody (Middle Region)

Catalog No. ABIN633086

Product Details anti-TUBG2 Antibody

Target: TUBG2 (Tubulin, gamma 2 (TUBG2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUBG2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Gamma Tubulin 2 antibody was raised against the middle region of TUBG2

Purification: Affinity purified

Immunogen: Gamma Tubulin 2 antibody was raised using the middle region of TUBG2 corresponding to a region with amino acids FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Gamma Tubulin 2 Blocking Peptide, catalog no. 33R-2866, is also available for use as a blocking control in assays to test for specificity of this Gamma Tubulin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUBG2

Target: TUBG2 (Tubulin, gamma 2 (TUBG2))

Abstract: TUBG2 Products

Background: Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Microtubule Dynamics, M Phase