beta Actin antibody (Middle Region)
-
- Target See all beta Actin (ACTB) Antibodies
- beta Actin (ACTB) (Actin, beta (ACTB))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog, Drosophila melanogaster, C. elegans
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This beta Actin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Beta Actin antibody was raised against the middle region of ACTB
- Purification
- Affinity purified
- Immunogen
- beta Actin antibody was raised using the middle region of ACTB corresponding to a region with amino acids TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
- Top Product
- Discover our top product ACTB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Beta Actin Blocking Peptide, catalog no. 33R-9203, is also available for use as a blocking control in assays to test for specificity of this Beta Actin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- beta Actin (ACTB) (Actin, beta (ACTB))
- Alternative Name
- beta Actin (ACTB Products)
- Background
- This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Cell-Cell Junction Organization, Maintenance of Protein Location, Phototransduction
-