A1BG antibody (N-Term)

Catalog No. ABIN630152

Product Details anti-A1BG Antibody

Target: A1BG (alpha-1-B Glycoprotein (A1BG))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This A1BG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: A1 BG antibody was raised against the N terminal of A1 G

Purification: Purified

Immunogen: A1 BG antibody was raised using the N terminal of A1 G corresponding to a region with amino acids ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

A1BG Blocking Peptide, catalog no. 33R-4184, is also available for use as a blocking control in assays to test for specificity of this A1BG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 G antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for A1BG

Target: A1BG (alpha-1-B Glycoprotein (A1BG))

Alternative Name: A1BG (A1BG Products)

Background: A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.

Molecular Weight: 52 kDa (MW of target protein)