TLR5 antibody (AA 151-181)

Catalog No. ABIN342758

Product Details anti-TLR5 Antibody

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Binding Specificity: AA 151-181

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This TLR5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), ELISA, Immunocytochemistry (ICC), Flow Cytometry (FACS)

Specificity: Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR5 and was not tested for cross-reactivity to mouse TLR5.

Predicted Reactivity: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%) Colobus monkey, Baboon (97%) Marmoset (94%) Sheep, Goat, Panda, Water buffalo (84%) Zebu, Bovine (81%).

Purification: Immunoaffinity purified

Immunogen: Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%), Colobus monkey, Baboon (97%), Marmoset (94%), Sheep, Goat, Panda, Water buffalo (84%), Zebu, Bovine (81%).

Type of Immunogen: Synthetic peptide

Application Details

Application Notes: Approved: ELISA (1:35000), Flo (1:50), ICC (1:250), IHC (1:125), WB (1:100)

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid freeze-thaw cycles.

Storage: -20 °C,-80 °C

Storage Comment: Short term: -20°C
Long term: -70°C
Avoid freeze-thaw cycles.

Target Details for TLR5

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Alternative Name: TLR5 (TLR5 Products)

Background: Name/Gene ID: TLR5
Family: Toll-like Receptor

Synonyms: TLR5, TIL3, Toll-like receptor 5, SLEB1

Gene ID: 7100

UniProt: O60602

Pathways: TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades